PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26906-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 263aa    MW: 27751.8 Da    PI: 9.1807
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26906-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1122.7e-353291261
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     +e+ l+cprCdstntkfCy+nnysl+qPr+fC+aCrryWt+GGal nvPvGg  r++ k+
  TRIUR3_26906-P1 32 PESGLNCPRCDSTNTKFCYFNNYSLTQPRHFCRACRRYWTRGGALHNVPVGGRYRRHAKR 91
                     67889************************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-341690IPR003851Zinc finger, Dof-type
PfamPF027013.1E-303590IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.5773690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
AGGGGGDGGG GGRNSKLMSM SERARLAGVP QPESGLNCPR CDSTNTKFCY FNNYSLTQPR  60
HFCRACRRYW TRGGALHNVP VGGRYRRHAK RSAKPKAAST ASGAGEGTPS VTSMTPNTTT  120
SSPALQYSIF PHAMDHQTAG QLAVAMPTTM AATQGMFHLG LQSGGMEQWG AALMQSFPFL  180
QAMDHQMVGP PAAAMPTTMA AMQDMFQQVL QSGASGDNGG DHHFHQQQQQ DYTSSRAIYG  240
DVVNGNGGGG YNFYSTTSNA PGN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-154HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753866.12e-57PREDICTED: dof zinc finger protein DOF3.2-like
TrEMBLT1N8V50.0T1N8V5_TRIUA; Uncharacterized protein
STRINGBRADI2G62380.11e-57(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-40OBF-binding protein 3